{ } }, "event" : "RevokeSolutionAction", // We made it! LITHIUM.Dialog.options['424451256'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; "includeRepliesModerationState" : "false", "event" : "markAsSpamWithoutRedirect", "event" : "ProductMessageEdit", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1677616,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }); } }, "event" : "MessagesWidgetEditCommentForm", element.addClass('active'); $(document).keydown(function(e) { } "actions" : [ "event" : "expandMessage", } // Set start to true only if the first key in the sequence is pressed }, { { "quiltName" : "ForumMessage", ] "action" : "rerender" LITHIUM.Cache.CustomEvent.set([{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1676295}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1676697}},{"elementId":"link_20","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1676697}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1676781}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1677616}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1677804}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2504044}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519298}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519069}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518535}},{"elementId":"link_39","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2517764}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2519947}},{"elementId":"link_43","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518973}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518744}},{"elementId":"link_48","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518298}},{"elementId":"link_50","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2518127}},{"elementId":"link_52","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2517837}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2517792}},{"elementId":"link_57","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516597}},{"elementId":"link_59","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516406}},{"elementId":"link_61","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2516271}}]); "actions" : [ "action" : "pulsate" { "truncateBodyRetainsHtml" : "false", "context" : "envParam:entity", { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); } ] { "action" : "rerender" { ] "event" : "MessagesWidgetEditAnswerForm", }, window.location.replace('/t5/user/userloginpage'); "event" : "AcceptSolutionAction", { }, { { "context" : "envParam:quiltName", LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ] } } "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Tipp: Ist dieses Profil schon vorhanden ist, nutz es am besten. "event" : "markAsSpamWithoutRedirect", "action" : "pulsate" "event" : "deleteMessage", "linkDisabled" : "false" "kudosable" : "true", "context" : "envParam:quiltName", "action" : "rerender" "message" : "1676697", "context" : "envParam:quiltName,expandedQuiltName", lithadmin: [] // enable redirect to login page when "logmein" is typed into the void =) im Firefox ist super langsam und macht so keinen Spaß. "actions" : [ "componentId" : "kudos.widget.button", } } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } }); "accessibility" : false, } { } { { } ] ] "kudosable" : "true", "displaySubject" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); { "context" : "envParam:quiltName,message", watching = false; "actions" : [ { "selector" : "#messageview_2", "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); }, "context" : "", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); }, ] "event" : "markAsSpamWithoutRedirect", "eventActions" : [ "action" : "addClassName" }, "disableLinks" : "false", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "initiatorDataMatcher" : "data-lia-kudos-id" "useSubjectIcons" : "true", "context" : "envParam:selectedMessage", { LITHIUM.CheckOnline({"checkOnlineUrl":"/t5/status/blankpage","offlineText":"Sie verfügen derzeit über keine Internetverbindung. "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234512}); "eventActions" : [ } "event" : "ProductMessageEdit", { "useCountToKudo" : "false", { LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); { ] { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":502,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk10BVlfbVM5GStWUAsOUhcYelpGAEQIXEZPFF4BWR5OR0haB1dVEQNaOBpHUB8VakkIBFVUBV0AERgQA0QHVFcrBhVeBAEHAlEBUAsBUVUDSBdYV2cWUxRwVkBYGlUZEV9RNVcBXHwDD1JGDxFyXRdDC21dEgtUNFRUURBJFA1afw0AXghQEQ4QEUQTXBBOQFwHd1xAEF8UAFheEQcVSBdYV2YdFFwbVldWD1BUBVIfUQZVAB9WVQBSGAsAA1EbVAsBU1pSB1cKUVEEFEobWQEsWABQelAQXxQlWF4OO1ZGGRFfUTdTFU1kUDNCAUdKFghHZSN1dyE2Fw1RE3JgKntGVFcREVYDUEAUZS1zNHwSFg1HDVYdXVZYCUZ1ey8rY0QKEUlP"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "action" : "rerender" Ups. { "displayStyle" : "horizontal", })(LITHIUM.jQuery); "eventActions" : [ "event" : "expandMessage", "}); Wende dich an Vodafone, Hatte in großen Städten auch kaum mehr, da die LTE Netzte meist hoffnungslos überlastet sind, Wohne aber in einer Stadt mit 10.000 Einwohnern. "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", } { ', 'ajax'); ] "context" : "", "action" : "rerender" }); "disableKudosForAnonUser" : "false", }, "eventActions" : [ }, } "actions" : [ ] ] }, ;(function($) { "context" : "", "actions" : [ } "entity" : "1677616", "context" : "lia-deleted-state", ] "action" : "rerender" "eventActions" : [ } "actions" : [ "event" : "expandMessage", "event" : "MessagesWidgetCommentForm", "actions" : [ }); window.location.replace('/t5/user/userloginpage'); }, } "kudosLinksDisabled" : "false", { }, "actions" : [ } ] LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "action" : "rerender" { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", $(this).toggleClass("view-btn-open view-btn-close"); "kudosable" : "true", Handy habe ich schon mehrmals neu gestartet und die mobilen Daten ein und ausgeschalten aber verändern tut sich da nix. "kudosable" : "true", "actions" : [ ] "actions" : [ "action" : "rerender" "context" : "lia-deleted-state", }, { "actions" : [ "context" : "", "actions" : [ }, ;(function($) { }, $(this).addClass('active') ] "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); "action" : "rerender" }; "useTruncatedSubject" : "true", "event" : "MessagesWidgetMessageEdit", "event" : "removeThreadUserEmailSubscription", }, "context" : "envParam:quiltName", ] ] }; "actions" : [ } }, { }, { LITHIUM.AjaxSupport.useTickets = false; { { "initiatorDataMatcher" : "data-lia-kudos-id" ] { "action" : "rerender" { { Mobile Daten sehr langsam ... Seit etwa 11.12.2014 fühlt sich das mobile Internet unkomfortabel langsam an. ] }, }, { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] { } "actions" : [ "event" : "RevokeSolutionAction",